This tab shows an overview of the mutation data [more details]
Gene Name:
FBXW7_NM_018315_2
Mutation Id:
COSM74637
AA Mutation:
p.R425C ( Substitution - Missense )
CDS Mutation:
c.1273C>T ( Substitution )
GRCh37:
Ensembl Contig View4:153247284..153247294
COSMIC Genome Browser:
COSMIC JBrowse 4:153247284..153247294
Ever confirmed somatic:
Yes
This tab displays the distribution of mutated samples and tissue types. [more details]
This tab displays a table of muated samples, with tissue, histology and zygosity information. Publication information is also included, where available, with links to PUBMED. [more details]
Sample name Gene name Transcript Primary Tissue Histology Pubmed ID Zygosity Somatic Status Sample Source
This tab displays a table of protein features [more details]
View Identifier Source Feature Start End Status Score
PF00400 Pfam WD40:408-444 408 444 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :WD40:408-444( 411- 447 )
Q59ET6 G3DSA:2.130.10.10 G3DSA:2.130.10.10 284 522 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :G3DSA:2.130.10.10( 287- 525 )
Q59ET6 Pfam-B_5130 Pfam-B_5130 352 466 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :Pfam-B_5130( 355- 469 )
Q59ET6 Pfam-B_17350 Pfam-B_17350 391 582 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :Pfam-B_17350( 394- 585 )
Q59ET6 Pfam-B_17949 Pfam-B_17949 386 441 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :Pfam-B_17949( 389- 444 )
Q59ET6 WD40 WD40 408 444 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :WD40( 411- 447 )
Q59ET6 WD_REPEATS_2 WD_REPEATS_2 414 453 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :WD_REPEATS_2( 417- 456 )
Q59ET6 WD_REPEATS_REGION WD_REPEATS_REGION 293 576 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :WD_REPEATS_REGION( 296- 579 )
Q59ET6 PTHR22844:SF95 PTHR22844:SF95 72 623 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :PTHR22844:SF95( 75- 626 )
Q59ET6 PTHR22844 PTHR22844 72 623 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :PTHR22844( 75- 626 )
Q59ET6 WD40 WD40 407 444 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :WD40( 410- 447 )
Q59ET6 SSF50978 SSF50978 285 609 Overlap 99.52
FBXW7_NM_018315_2 MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 Q59ET6 ...PRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRT 60 FBXW7_NM_018315_2 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 Q59ET6 HGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLV 120 FBXW7_NM_018315_2 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 Q59ET6 PCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSC 180 FBXW7_NM_018315_2 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 Q59ET6 EPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLL 240 FBXW7_NM_018315_2 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 Q59ET6 WREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHD 300 FBXW7_NM_018315_2 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 Q59ET6 DHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTD 360 FBXW7_NM_018315_2 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 Q59ET6 RTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGH 420 FBXW7_NM_018315_2 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 Q59ET6 VAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLD 480 FBXW7_NM_018315_2 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 Q59ET6 TSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGP 540 FBXW7_NM_018315_2 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 Q59ET6 NKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNT 600 FBXW7_NM_018315_2 KLVCAVGSRNGTEETKLLVLDFDVDMK Q59ET6 KLVCAVGSRNGTEETKLLVLDFDVDMK

More details

Wildtype Residue : R Mutant Position : 425 Mutant label : p.R425C Feature Name :SSF50978( 288- 612 )
This tab displays a table of pathways affected by the mutation [more details]
SourcePathways
WikiPathwayDelta-Notch Signaling Pathway
This tab displays a table of references for the mutation [more details]
Reference Title Author Year Journal Status COSMIC Pubmed