This tab shows an overview of the mutation data [more details]
Gene Name:
KRAS
Mutation Id:
COSM532
AA Mutation:
p.G13D ( Substitution - Missense )
CDS Mutation:
c.38G>A ( Substitution )
GRCh37:
Ensembl Contig View12:25398276..25398286
COSMIC Genome Browser:
COSMIC JBrowse 12:25398276..25398286
CDD:
NP_203524.1
Ever confirmed somatic:
Yes
This tab displays the distribution of mutated samples and tissue types. [more details]
This tab displays a table of muated samples, with tissue, histology and zygosity information. Publication information is also included, where available, with links to PUBMED. [more details]
Sample name Gene name Transcript Primary Tissue Histology Pubmed ID Zygosity Somatic Status Sample Source
This tab displays a table of protein features [more details]
View Identifier Source Feature Start End Status Score
PF00071 Pfam Ras:5-165 5 165 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :Ras:5-165( 5- 165 )
P01116 Pfam low_complexity:7-15 7 15 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :low_complexity:7-15( 7- 15 )
P01116 G3DSA:3.40.50.300 G3DSA:3.40.50.300 3 165 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :G3DSA:3.40.50.300( 3- 165 )
P01116 Ras Ras 5 164 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :Ras( 5- 164 )
P01116 RASTRNSFRMNG RASTRNSFRMNG 4 25 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :RASTRNSFRMNG( 4- 25 )
P01116 RAS RAS 1 189 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :RAS( 1- 189 )
P01116 PTHR24070:SF54 PTHR24070:SF54 1 176 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :PTHR24070:SF54( 1- 176 )
P01116 PTHR24070 PTHR24070 1 176 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :PTHR24070( 1- 176 )
P01116 RAS RAS 1 166 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :RAS( 1- 166 )
P01116 SSF52540 SSF52540 3 164 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :SSF52540( 3- 164 )
P01116 small_GTP small_GTP 1 159 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :small_GTP( 1- 159 )
P01116 UniProt:curator GTPase KRas 1 186 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :GTPase KRas( 1- 186 )
P01116 UniProt:curator GTPase KRas, N-terminally processed 2 186 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :GTPase KRas, N-terminally processed( 2- 186 )
P01116 UniProt:curator GTP 10 17 Overlap 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :GTP( 10- 17 )
P01116 PubMed:8955068 UNIPROTKB_P01116_VARIANT_10_10_20_VAR_034601 10 10 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_10_10_20_VAR_034601( 10- 10 )
P01116 PubMed:16959974 UNIPROTKB_P01116_VARIANT_12_12_21_VAR_036305 12 12 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_12_12_21_VAR_036305( 12- 12 )
P01116 PubMed:6320174 UNIPROTKB_P01116_VARIANT_12_12_22_VAR_006839 12 12 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_12_12_22_VAR_006839( 12- 12 )
P01116 PubMed:7773929 UNIPROTKB_P01116_VARIANT_12_12_23_VAR_016026 12 12 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_12_12_23_VAR_016026( 12- 12 )
P01116 PubMed:6695174 UNIPROTKB_P01116_VARIANT_12_12_24_VAR_016027 12 12 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_12_12_24_VAR_016027( 12- 12 )
P01116 PubMed:7773929 UNIPROTKB_P01116_VARIANT_12_12_25_VAR_016028 12 12 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_12_12_25_VAR_016028( 12- 12 )
P01116 PubMed:3034404 UNIPROTKB_P01116_VARIANT_12_12_26_VAR_006840 12 12 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_12_12_26_VAR_006840( 12- 12 )
P01116 PubMed:14534542 UNIPROTKB_P01116_VARIANT_13_13_27_VAR_016029 13 13 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_13_13_27_VAR_016029( 13- 13 )
P01116 PubMed:16247081 UNIPROTKB_P01116_VARIANT_13_13_28_VAR_065145 13 13 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_13_13_28_VAR_065145( 13- 13 )
P01116 PubMed:16474405 UNIPROTKB_P01116_VARIANT_14_14_29_VAR_026109 14 14 Proximity 90.43
KRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01116 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 KRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 P01116 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL 120 KRAS PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK.EKMSKDGKKKKK 180 P01116 PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC 180 KRAS KSKTKCVIM P01116 VKIKKCIIM

More details

Wildtype Residue : G Mutant Position : 13 Mutant label : p.G13D Feature Name :UNIPROTKB_P01116_VARIANT_14_14_29_VAR_026109( 14- 14 )
This tab displays a table of references for the mutation [more details]
Reference Title Author Year Journal Status COSMIC Pubmed