This tab shows an overview of the mutation data [more details]
Gene Name:
TP53
Mutation Id:
COSM10662
AA Mutation:
p.R248Q ( Substitution - Missense )
CDS Mutation:
c.743G>A ( Substitution )
GRCh37:
Ensembl Contig View17:7577533..7577543
COSMIC Genome Browser:
COSMIC JBrowse 17:7577533..7577543
Ever confirmed somatic:
Yes
This tab displays the distribution of mutated samples and tissue types. [more details]
This tab displays a table of muated samples, with tissue, histology and zygosity information. Publication information is also included, where available, with links to PUBMED. [more details]
Sample name Gene name Transcript Primary Tissue Histology Pubmed ID Zygosity Somatic Status Sample Source
This tab displays a table of protein features [more details]
View Identifier Source Feature Start End Status Score
Q2XN98 UniProt:curator Cellular tumor antigen p53 1 393 Overlap 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :Cellular tumor antigen p53( 1- 393 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_DNA_BIND_102_292_2 102 292 Overlap 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_DNA_BIND_102_292_2( 102- 292 )
Q2XN98 UniProt:curator Interaction with HIPK1 100 370 Overlap 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :Interaction with HIPK1( 100- 370 )
Q2XN98 UniProt:curator Required for interaction with ZNF385A 100 300 Overlap 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :Required for interaction with ZNF385A( 100- 300 )
Q2XN98 UniProt:curator Interaction with AXIN1 116 292 Overlap 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :Interaction with AXIN1( 116- 292 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_244_244_943_VAR_047186 244 244 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_244_244_943_VAR_047186( 244- 244 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_244_244_944_VAR_045231 244 244 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_244_244_944_VAR_045231( 244- 244 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_244_244_945_VAR_045232 244 244 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_244_244_945_VAR_045232( 244- 244 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_244_244_946_VAR_045233 244 244 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_244_244_946_VAR_045233( 244- 244 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_244_244_947_VAR_045234 244 244 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_244_244_947_VAR_045234( 244- 244 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_244_244_948_VAR_045235 244 244 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_244_244_948_VAR_045235( 244- 244 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_244_244_949_VAR_045236 244 244 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_244_244_949_VAR_045236( 244- 244 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_245_245_950_VAR_005971 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_950_VAR_005971( 245- 245 )
Q2XN98 PubMed:1978757 UNIPROTKB_P04637_VARIANT_245_245_951_VAR_005972 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_951_VAR_005972( 245- 245 )
Q2XN98 PubMed:2259385 UNIPROTKB_P04637_VARIANT_245_245_952_VAR_005973 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_952_VAR_005973( 245- 245 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_245_245_953_VAR_045237 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_953_VAR_045237( 245- 245 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_245_245_954_VAR_045851 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_954_VAR_045851( 245- 245 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_245_245_955_VAR_045852 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_955_VAR_045852( 245- 245 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_245_245_956_VAR_045853 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_956_VAR_045853( 245- 245 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_245_245_957_VAR_045854 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_957_VAR_045854( 245- 245 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_245_245_958_VAR_045238 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_958_VAR_045238( 245- 245 )
Q2XN98 PubMed:8829627 UNIPROTKB_P04637_VARIANT_245_245_959_VAR_005974 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_959_VAR_005974( 245- 245 )
Q2XN98 PubMed:2263646 UNIPROTKB_P04637_VARIANT_245_245_960_VAR_005975 245 245 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_245_245_960_VAR_005975( 245- 245 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_246_246_961_VAR_045239 246 246 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_246_246_961_VAR_045239( 246- 246 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_246_246_962_VAR_045240 246 246 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_246_246_962_VAR_045240( 246- 246 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_246_246_963_VAR_044020 246 246 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_246_246_963_VAR_044020( 246- 246 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_246_246_964_VAR_005976 246 246 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_246_246_964_VAR_005976( 246- 246 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_246_246_965_VAR_005977 246 246 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_246_246_965_VAR_005977( 246- 246 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_246_246_966_VAR_005978 246 246 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_246_246_966_VAR_005978( 246- 246 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_247_247_969_VAR_045241 247 247 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_247_247_969_VAR_045241( 247- 247 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_247_247_970_VAR_045855 247 247 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_247_247_970_VAR_045855( 247- 247 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_247_247_971_VAR_005980 247 247 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_247_247_971_VAR_005980( 247- 247 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_247_247_972_VAR_045242 247 247 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_247_247_972_VAR_045242( 247- 247 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_247_247_973_VAR_045243 247 247 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_247_247_973_VAR_045243( 247- 247 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_247_247_974_VAR_047189 247 247 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_247_247_974_VAR_047189( 247- 247 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_247_247_975_VAR_045244 247 247 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_247_247_975_VAR_045244( 247- 247 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_248_248_976_VAR_045245 248 248 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_248_248_976_VAR_045245( 248- 248 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_248_248_977_VAR_005981 248 248 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_248_248_977_VAR_005981( 248- 248 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_248_248_978_VAR_005982 248 248 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_248_248_978_VAR_005982( 248- 248 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_248_248_979_VAR_045246 248 248 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_248_248_979_VAR_045246( 248- 248 )
Q2XN98 PubMed:7887414 UNIPROTKB_P04637_VARIANT_248_248_980_VAR_005983 248 248 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_248_248_980_VAR_005983( 248- 248 )
Q2XN98 PubMed:1978757 UNIPROTKB_P04637_VARIANT_248_248_981_VAR_005984 248 248 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_248_248_981_VAR_005984( 248- 248 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_984_VAR_005985 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_984_VAR_005985( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_985_VAR_045247 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_985_VAR_045247( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_986_VAR_045248 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_986_VAR_045248( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_987_VAR_033037 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_987_VAR_033037( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_988_VAR_045856 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_988_VAR_045856( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_989_VAR_005986 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_989_VAR_005986( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_990_VAR_045249 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_990_VAR_045249( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_249_249_991_VAR_045250 249 249 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_249_249_991_VAR_045250( 249- 249 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_992_VAR_045251 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_992_VAR_045251( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_993_VAR_045857 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_993_VAR_045857( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_994_VAR_045252 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_994_VAR_045252( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_995_VAR_047192 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_995_VAR_047192( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_996_VAR_045858 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_996_VAR_045858( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_997_VAR_045253 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_997_VAR_045253( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_998_VAR_045254 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_998_VAR_045254( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_250_250_999_VAR_045255 250 250 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_250_250_999_VAR_045255( 250- 250 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_251_251_1000_VAR_045256 251 251 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_251_251_1000_VAR_045256( 251- 251 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_251_251_1001_VAR_045257 251 251 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_251_251_1001_VAR_045257( 251- 251 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_251_251_1002_VAR_045258 251 251 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_251_251_1002_VAR_045258( 251- 251 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_251_251_1003_VAR_005987 251 251 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_251_251_1003_VAR_005987( 251- 251 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_251_251_1004_VAR_033038 251 251 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_251_251_1004_VAR_033038( 251- 251 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_251_251_1005_VAR_045259 251 251 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_251_251_1005_VAR_045259( 251- 251 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_251_251_1006_VAR_045260 251 251 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_251_251_1006_VAR_045260( 251- 251 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_252_252_1007_VAR_045261 252 252 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_252_252_1007_VAR_045261( 252- 252 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_252_252_1008_VAR_045262 252 252 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_252_252_1008_VAR_045262( 252- 252 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_252_252_1009_VAR_045263 252 252 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_252_252_1009_VAR_045263( 252- 252 )
Q2XN98 PubMed:1978757 UNIPROTKB_P04637_VARIANT_252_252_1010_VAR_005988 252 252 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_252_252_1010_VAR_005988( 252- 252 )
Q2XN98 UniProt:curator UNIPROTKB_P04637_VARIANT_252_252_1011_VAR_045264 252 252 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_VARIANT_252_252_1011_VAR_045264( 252- 252 )
Q2XN98 PubMed:19536131 UNIPROTKB_P04637_MUTAGEN_248_248_1436 248 248 Proximity 100.00
TP53 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 Q2XN98 MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP 60 TP53 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 Q2XN98 DEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK 120 TP53 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 Q2XN98 SVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHE 180 TP53 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 Q2XN98 RCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS 240 TP53 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 Q2XN98 SCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPHHELP 300 TP53 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 Q2XN98 PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG 360 TP53 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD Q2XN98 GSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD

More details

Wildtype Residue : R Mutant Position : 248 Mutant label : p.R248Q Feature Name :UNIPROTKB_P04637_MUTAGEN_248_248_1436( 248- 248 )
This tab displays a table of pathways affected by the mutation [more details]
SourcePathways
WikiPathwayAndrogen Receptor Signaling Pathway
WikiPathwayAMPK signaling
WikiPathwayDNA damage response
WikiPathwaymiRNAs involved in DDR
WikiPathwayFluoropyrimidine Activity
WikiPathwayFolate
WikiPathwayCell cycle
WikiPathwayApoptosis
WikiPathwayMAPK signaling pathway
WikiPathwayTGF-beta Receptor Signaling Pathway
WikiPathwayWnt Signaling Pathway and Pluripotency
WikiPathwayG1 to S cell cycle control
WikiPathwayDelta-Notch Signaling Pathway
WikiPathwaySenescence and Autophagy
WikiPathwayErbB signaling pathway
WikiPathwayDNA damage response (only ATM dependent)
WikiPathwayDNA damage response
This tab displays a table of references for the mutation [more details]
Reference Title Author Year Journal Status COSMIC Pubmed