This tab shows an overview of the mutation data [more details]
Gene Name:
HRAS
Mutation Id:
COSM249860
AA Mutation:
p.H27H ( Substitution - coding silent )
CDS Mutation:
c.81T>C ( Substitution )
GRCh37:
Ensembl Contig View11:534237..534247
COSMIC Genome Browser:
COSMIC JBrowse 11:534237..534247
CDD:
NP_005334.1
Ever confirmed somatic:
No
This tab displays the distribution of mutated samples and tissue types. [more details]
This tab displays a table of muated samples, with tissue, histology and zygosity information. Publication information is also included, where available, with links to PUBMED. [more details]
Sample name Gene name Transcript Primary Tissue Histology Pubmed ID Zygosity Somatic Status Sample Source
This tab displays a table of protein features [more details]
View Identifier Source Feature Start End Status Score
PF00071 Pfam Ras:5-165 5 165 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :Ras:5-165( 5- 165 )
P01112 G3DSA:3.40.50.300 G3DSA:3.40.50.300 3 165 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :G3DSA:3.40.50.300( 3- 165 )
P01112 Ras Ras 5 164 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :Ras( 5- 164 )
P01112 RAS RAS 1 188 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :RAS( 1- 188 )
P01112 PTHR24070:SF54 PTHR24070:SF54 1 185 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :PTHR24070:SF54( 1- 185 )
P01112 PTHR24070 PTHR24070 1 185 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :PTHR24070( 1- 185 )
P01112 RAS RAS 1 166 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :RAS( 1- 166 )
P01112 SSF52540 SSF52540 3 164 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :SSF52540( 3- 164 )
P01112 small_GTP small_GTP 1 159 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :small_GTP( 1- 159 )
P01112 UniProt:curator GTPase HRas 1 186 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :GTPase HRas( 1- 186 )
P01112 UniProt:curator GTPase HRas, N-terminally processed 2 186 Overlap 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :GTPase HRas, N-terminally processed( 2- 186 )
P01112 PubMed:3011420 UNIPROTKB_P01112_MUTAGEN_26_26_38 26 26 Proximity 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :UNIPROTKB_P01112_MUTAGEN_26_26_38( 26- 26 )
P01112 PubMed:3011420 UNIPROTKB_P01112_MUTAGEN_29_29_39 29 29 Proximity 100.00
HRAS MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 P01112 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG 60 HRAS QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 P01112 QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 120 HRAS AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 P01112 AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG 180 HRAS CMSCKCVLS P01112 CMSCKCVLS

More details

Wildtype Residue : H Mutant Position : 27 Mutant label : p.H27H Feature Name :UNIPROTKB_P01112_MUTAGEN_29_29_39( 29- 29 )
This tab displays a table of references for the mutation [more details]
Reference Title Author Year Journal Status COSMIC Pubmed